PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009611805.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 224aa    MW: 26396.4 Da    PI: 4.9404
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009611805.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-183181656
                    S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +ft+eq++ Le++F+ + ++  +++ +LA+ lgL+ rqV +WFqN+Ra++k
  XP_009611805.1 31 RFTDEQVKFLESMFRLETKLEPRKKLQLARDLGLQPRQVAIWFQNKRARWK 81
                    7*************************************************9 PP

2HD-ZIP_I/II117.86e-3829119393
     HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      +r+++eqvk+LE++F+ e+kLep++K +lar+Lglqprqva+WFqn+RAR+k+kqlE++y +Lk+++d+l+ + ++L++e+e+L  +l++
  XP_009611805.1  29 GKRFTDEQVKFLESMFRLETKLEPRKKLQLARDLGLQPRQVAIWFQNKRARWKSKQLEHEYIVLKAKFDNLNMQFQSLKTEKERLLIQLET 119
                     58***********************************************************************************988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-171985IPR009057Homeodomain-like
PROSITE profilePS5007116.7142383IPR001356Homeobox domain
SMARTSM003897.8E-162587IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-193089IPR009057Homeodomain-like
PfamPF000464.1E-163181IPR001356Homeobox domain
CDDcd000867.35E-133184No hitNo description
PRINTSPR000311.6E-55463IPR000047Helix-turn-helix motif
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
PRINTSPR000311.6E-56379IPR000047Helix-turn-helix motif
PfamPF021831.2E-1283124IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MEPQEFQELE KSESPNSKRA LKKKSTENGK RFTDEQVKFL ESMFRLETKL EPRKKLQLAR  60
DLGLQPRQVA IWFQNKRARW KSKQLEHEYI VLKAKFDNLN MQFQSLKTEK ERLLIQLETL  120
NDELEKSSRI QDLKDNELYT SSENGGTDLE LKDSPGCSNA RFDHKRVKEE DDDTAEETDK  180
YFTPKEETEF WNLEELGDSS LEHWCVGLGS SFNQSCGNSK LWDF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611805.11e-163PREDICTED: homeobox-leucine zipper protein ATHB-7-like
RefseqXP_016442723.11e-163PREDICTED: homeobox-leucine zipper protein ATHB-7-like
TrEMBLA0A0V0H8G34e-99A0A0V0H8G3_SOLCH; Putative homeobox-leucine zipper protein ATHB-7-like
STRINGPGSC0003DMT4000476225e-97(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.18e-40homeobox 7